The Amino Acid Sequence of Monal Pheasant Lysozyme and Its Activity

نویسندگان
چکیده

برای دانلود رایگان متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

Reptile lysozyme: the complete amino acid sequence of soft-shelled turtle lysozyme and its activity.

Soft-shelled turtle egg-white lysozyme was purified and sequenced. Lysozyme was reduced and carboxymethylated to fragment it with trypsin, V8 protease and CNBr. The peptides yielded were purified by RP-HPLC and sequenced. Every trypsin peptide was overlapped by V8 protease peptides and CNBr fragment. The amino acid sequence was compared with other lysozymes. This lysozyme has an extra Gly resid...

متن کامل

The amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.

The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGM...

متن کامل

Amino Acid Sequence in Lysozyme

The previous paper in this series (Thompson, 1955) reported some amino acid sequences in lysozyme which were deduced from the structures of a number of small peptides isolated from partial acid hydrolysates by displacement chromatography on ion-exchange resins and further fractionation on paper chromatograms. Despite the success achieved by Partridge and co-workers (see Partridge & Brimley, 195...

متن کامل

The amino acid sequence of satyr tragopan lysozyme and its activity.

The amino acid sequence of satyr tragopan lysozyme and its activity was analyzed. Carboxymethylated lysozyme was digested with trypsin and the resulting peptides were sequenced. The established amino acid sequence had three amino acid substitutions at positions 103 (Asn to Ser), 106 (Ser to Asn), and 121 (His to Gln) comparing with Temminck's tragopan lysozyme and five amino acid substitutions ...

متن کامل

The Amino Acid Sequence of Egg White Lysozyme.

The separation and characterization of peptic and chymotryptic peptides of egg white lysozyme by phosphocellulose chromatography has been reported (1). In addition, a group of 18 different tryptic peptides of lysozyme, the total composition of which approximates that of the whole protein, has been characterized (2). This communication reports further studies that define a unique sequence for th...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

ژورنال

عنوان ژورنال: Bioscience, Biotechnology, and Biochemistry

سال: 1998

ISSN: 0916-8451,1347-6947

DOI: 10.1271/bbb.62.1988